NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209496_10566768

Scaffold Ga0209496_10566768


Overview

Basic Information
Taxon OID3300027890 Open in IMG/M
Scaffold IDGa0209496_10566768 Open in IMG/M
Source Dataset NameWetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)610
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland → Wetland Microbial Communities From Old Woman Creek Reserve In Ohio, Usa

Source Dataset Sampling Location
Location NameOld Woman Creek National Estuarine Research Reserve, Ohio, USA
CoordinatesLat. (o)41.224Long. (o)-82.304Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F093160Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0209496_105667681F093160N/AVWLWPQLSACHGIDDEAEEADKMAVDPSGNVYIIDDRYRVAKINGQTDKVVEVLAIPGYDCEKTVPDGSNEVLRNTANNIAYMALGQGKLYVTSEQNTLTLIQWIKQGKKTLTKLTTLTLPEAAELDAITTDPKLNQVYITDESLAALWILKGACANGEGVHCTP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.