Scaffold Ga0208980_10042252

Overview

Basic Information

• Taxon OID: 3300027887
• Scaffold ID: Ga0208980_10042252
• Source Dataset Name: Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2657
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming

Source Dataset Sampling Location

• Location Name: Twitchell Island, Sacramento and San Joaquin Delta, California, USA
• Coordinates
  • Lat. (^o): 38.107
  • Long. (^o): -121.6475
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076701	Metagenome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208980_100422524	F076701	AGGAG	VTYRPTFRKQGDGSRCAWSNCGPASHAMAADRHRKGVDPKTPHGWLPTPSEIRNYMTPNSCGGTNLQQNDAACTHMYLVNMDVRYGVPWTTFRSAIISGRGAVVQILYSKVPARFDGSPGFGGNHAVFVNERRSSDGAYLVYDPLADGRRAGIPKGPQWWPASVLQAAAYAMPGTAAGCVNASFTRDTEV