NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209713_10007000

Scaffold Ga0209713_10007000


Overview

Basic Information
Taxon OID3300027883 Open in IMG/M
Scaffold IDGa0209713_10007000 Open in IMG/M
Source Dataset NameMarine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7418
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (15.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean
CoordinatesLat. (o)78.8697Long. (o)8.1122Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008453Metagenome333Y
F009699Metagenome / Metatranscriptome314Y

Sequences

Protein IDFamilyRBSSequence
Ga0209713_100070002F009699N/AMMTDKQALAFMQKVDSSAPFWKELHDEDRPTMNIQGTPTPRCLYNLMITRRDVNLYAKIGMKPHRLWKIGDVKAYFGLKGGKQKIADAINAIHDELIGRLENQDDE
Ga0209713_100070007F008453N/AMSNYAVYRVYKDWNKRPKTLMDGLTREQAQTIVRNTPSKDNSMVVFDEEPRDKQWGRKQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.