NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209169_10003094

Scaffold Ga0209169_10003094


Overview

Basic Information
Taxon OID3300027879 Open in IMG/M
Scaffold IDGa0209169_10003094 Open in IMG/M
Source Dataset NameWarmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9869
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From The Hubbard Brook Experimental Forest, New Hampshire, Under Manipulated Climate Change Conditions.

Source Dataset Sampling Location
Location NameUSA: New Hampshire, Hubbard Brook experimental Forest
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014643Metagenome / Metatranscriptome261Y
F020643Metagenome / Metatranscriptome222Y
F103682Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0209169_1000309411F020643N/AVDRGRGPPFRRLASGAVTVKFLRHLAAAVFAVAVIVGLGMLWAHASGSAGPRQAPSPEMLLRLQHIKEQVKAGVIGVRSDNGFHFADTGNLIRTCEIEAALAAAVITASVVRRRRHRMRRTTARA
Ga0209169_100030943F014643AGGAGMPQAPARRPTSESSDVANLVRLHHRRRGWAWVAMGSAIGLVVYVGIGVNLSENLTGTAGTLGVIPVFVLLALVLVGLVVAIVDTSRIHRADAAVRVSAKGSVSHYPLYAQAHRYPPRHHGSWVFVIFMLVAMTGITVAILPVEVNSWAYALGAGNQDTFNPVSYGQACNNLPRYSSCHMVTKGYLSKSGADVTWGSQVPLGRPFSVRDPIWAWGDGRNLITGDGSAIPNSIAGLFFDVIPFLLLYALVVLVRHAWSRRSQRTPVPAGPGPRVARQPQHPARGHHGSGVHRPAGRGRGRR
Ga0209169_100030945F103682AGGMMSNKPHLHPHKEEQHASRITRLLVAILVVGIIALLVALELTGRVEFRGRLILLRGGRSTLTAVSH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.