| Basic Information | |
|---|---|
| Taxon OID | 3300027877 Open in IMG/M |
| Scaffold ID | Ga0209293_10430867 Open in IMG/M |
| Source Dataset Name | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 686 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland → Wetland Microbial Communities From Old Woman Creek Reserve In Ohio, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Old Woman Creek National Estuarine Research Reserve, Ohio, USA | |||||||
| Coordinates | Lat. (o) | 41.2239 | Long. (o) | -82.3039 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002660 | Metagenome / Metatranscriptome | 539 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209293_104308671 | F002660 | AGGAGG | MSFTELLGNVGFFGAAVMICLVALSVFSVGLIVDKHRRFRSASRQSQAFKPVFGKFLHGGEVTELIDAVRSHQNSHVAQVVSAGIHEYDGVRQTGGDPVASLELVSSALEDSKAETMIQMKRGLGF |
| ⦗Top⦘ |