NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209023_10575974

Scaffold Ga0209023_10575974


Overview

Basic Information
Taxon OID3300027870 Open in IMG/M
Scaffold IDGa0209023_10575974 Open in IMG/M
Source Dataset NameFreshwater and sediment microbial communities from Lake Erie, Canada (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)664
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameLake Erie, Canada
CoordinatesLat. (o)42.285437Long. (o)-81.355591Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024048Metagenome / Metatranscriptome207Y
F053943Metagenome140Y

Sequences

Protein IDFamilyRBSSequence
Ga0209023_105759741F024048N/AMDEVVAPLLHNNEPVNDVAVSVELPQLFTTVTTGADGITFGAATPLPGRLVHPFTVCVTV
Ga0209023_105759742F053943N/AVKAEAAAPVLHNKGPLYPDVDNIELPQLFTTLTTSADGIAFGAATALREGLVHPFTVCVTVYVPAVATVIDEVVTPVLHNKEPVNDVAVNVELPQLFTTVTTGADTFEFNGAATPLPDGLVQPFTACLTV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.