NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209579_10001221

Scaffold Ga0209579_10001221


Overview

Basic Information
Taxon OID3300027869 Open in IMG/M
Scaffold IDGa0209579_10001221 Open in IMG/M
Source Dataset NameSurface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)21784
Total Scaffold Genes31 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)20 (64.52%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil → Surface Soil Microbial Communities From Centralia Pennsylvania, Which Are Recovering From An Underground Coalmine Fire.

Source Dataset Sampling Location
Location NameUSA: Pennsylvania, Centralia
CoordinatesLat. (o)40.7999Long. (o)-76.3402Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008316Metagenome / Metatranscriptome335Y
F032246Metagenome / Metatranscriptome180Y
F061068Metagenome / Metatranscriptome132Y

Sequences

Protein IDFamilyRBSSequence
Ga0209579_1000122123F008316N/AMSLKNAAFFALIGMTLLTVMLAVVFIRDVSALLAGAIAAITVLMEFINLLASLSVAVFLYVFYRAQS
Ga0209579_1000122125F032246GGAMGKVTIEIDSKWVKIVHSPVYWIVVTLQGLSISFAPLFLYWCGKGTLFHGTEWLFVPLCFGIIFFVGFFYMALGGAVIGQLRKKDFSA
Ga0209579_1000122126F061068N/AMTVHEKFVEDMNGAGIHTEGYLGRFFWEGPAARSDEQNGPTLLDIIKVTTVPLQWDRLDFNYIVYPVGKAGWKDSVADSEGDELEPDGYNDGYAAKPHKDVDEED

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.