Scaffold Ga0207433_10364065

Overview

Basic Information

• Taxon OID: 3300027863
• Scaffold ID: Ga0207433_10364065
• Source Dataset Name: Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 934
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.611006
  • Long. (^o): -110.440182

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002889	Metagenome / Metatranscriptome	523	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207433_103640652	F002889	GAGG	MNRNTRIFCFLVITLAALGGCSSEPAAKEAKKAPHRIQGKVQVLVEPGGAMDAALNAGGPSVYIWSGMRRYRLFLRTPVDVVHGNEYVAEGVNAQQVIDETGDPDQGKNGYPLASSCQRAVKMAWSNLAFDAIDAQAEVLRARVKRYPARPVFLVTRIRPATSEDRSTGSTEVTKDAAVGEKEVPEVSVAAEKQRALLVEGSPVQPAPLWQPEGGTARCKVVIDSDGMISDLQTGAQLCETVDWAKF