Scaffold Ga0207433_10006045

Overview

Basic Information

• Taxon OID: 3300027863
• Scaffold ID: Ga0207433_10006045
• Source Dataset Name: Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 21244
• Total Scaffold Genes: 32
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (9.38%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.611006
  • Long. (^o): -110.440182

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008501	Metagenome	332	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207433_1000604523	F008501	AGGAGG	MEKRRCLTLMPRSRRGALDLTDLAIGIVVLGITVSIGATILTNVRDTNTQNSAAYNLSNQAASGIAEYGNWFKILVIVGVASVVLSLIFLAFGRSGRVGETY