NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209611_10107309

Scaffold Ga0209611_10107309


Overview

Basic Information
Taxon OID3300027860 Open in IMG/M
Scaffold IDGa0209611_10107309 Open in IMG/M
Source Dataset NameHost-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1859
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Communities From Peat Moss Sphagnum Species From Minnesota, Usa

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008289Metagenome335Y

Sequences

Protein IDFamilyRBSSequence
Ga0209611_101073093F008289N/AMTSPQGMDELFWGGDHEDVNDWAERLTMAAEVRDFNADKLFKIAKLNL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.