Scaffold Ga0209503_10235013

Overview

Basic Information

• Taxon OID: 3300027859
• Scaffold ID: Ga0209503_10235013
• Source Dataset Name: Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 885
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: South Atlantic Ocean
• Coordinates
  • Lat. (^o): -17.283
  • Long. (^o): 2.9768
  • Depth (m): 30

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024116	Metagenome / Metatranscriptome	207	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209503_102350133	F024116	GGTGG	VNEDLKDYISIIVFLIVVLGGLVLIGSCDGGWSIAGYEV