NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209166_10000128

Scaffold Ga0209166_10000128


Overview

Basic Information
Taxon OID3300027857 Open in IMG/M
Scaffold IDGa0209166_10000128 Open in IMG/M
Source Dataset NameSurface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)97885
Total Scaffold Genes84 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)55 (65.48%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil → Surface Soil Microbial Communities From Centralia Pennsylvania, Which Are Recovering From An Underground Coalmine Fire.

Source Dataset Sampling Location
Location NameUSA: Pennsylvania, Centralia
CoordinatesLat. (o)40.7999Long. (o)-76.3402Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006810Metagenome / Metatranscriptome364Y
F067023Metagenome / Metatranscriptome126Y
F071561Metagenome / Metatranscriptome122Y
F072176Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0209166_100001283F071561GAGMRRLSALLSFLLLAYLANAQNRPEPIRLCVSTLQNSSHSALDTTWQRNQLMKMFERINKGKDVTKGKAARIGTVLLESNSETDPAVRDNNCQFILHTNVLEIIDSGTSDAGSSRPRPVEIGSARDDPRADSADDNRATIAYRIMRAGELEPWSSDILTAHDPLPDAMVISHLMDQIANRVADKLRERR
Ga0209166_1000012842F006810GAGMKPVLFSIALLLMLPTLVAAQAHKNQQGTIVRMRMTDCLGPEHGFMAAMSGGGKVEPGALCPEYVLVADQVVYVISGKSSEALIPLAETTRFRLQKNEMLIRIDDAAKESHFRIKSMVLRPEWDRTEQLQQAERNAIINHEVDPAMVSQPH
Ga0209166_1000012865F067023GGAGGMTPEERQRMDSLCKRIAVEKDPQTFDQLVKELNDLLEQKHERIHPEHNDKSKK
Ga0209166_1000012882F072176N/AMIKAHVNEMGIVMRFDSMADNLSSDQWTTLLDQLKSHYIPSFYQLGKRMHVDFDAEGGGMRAVIYFTPQTVSQEDAIRILKQRGMQVFDMRENPGGK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.