Scaffold Ga0209066_10001801

Overview

Basic Information

• Taxon OID: 3300027851
• Scaffold ID: Ga0209066_10001801
• Source Dataset Name: Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 27532
• Total Scaffold Genes: 35
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 31 (88.57%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location

• Location Name: Pennsylvania, USA
• Coordinates
  • Lat. (^o): 40.0132
  • Long. (^o): -79.0717

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019676	Metagenome / Metatranscriptome	228	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209066_1000180128	F019676	GGAG	MKSRNVVICVAASVVALSFLTVGCDREVSKSKSTSVSRDGTVKSQEKIVTQSSDGTVTKTQESKTTEPNNK