NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209066_10001286

Scaffold Ga0209066_10001286


Overview

Basic Information
Taxon OID3300027851 Open in IMG/M
Scaffold IDGa0209066_10001286 Open in IMG/M
Source Dataset NameFreshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)33808
Total Scaffold Genes50 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)46 (92.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location
Location NamePennsylvania, USA
CoordinatesLat. (o)40.0132Long. (o)-79.0717Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000220Metagenome / Metatranscriptome1544Y
F103122Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0209066_1000128629F000220GGAMSDEKPADILSKVLSYVDSPFKLFALILMAVFAFSGYFVWQNQELLMGAYKESKKMPSIVEDRVEDAAAHLFKTTNATVVAVFKVNPMFGTRVLYRAYTKEGRDKANDGLDVGLFTQNAANNADVVRLMASEIPCGEYRSAQSEMGLWYIAKGVTYTCRISIPPDPSRFVGQITVGWDNEPADIQVARTMMEIASTMLSRSKQ
Ga0209066_1000128648F103122AGGMMTLEQIRDALSDRMPMKVAEATGVHYNTIRQVRDNPNANPTHKVMLALSNYFESRKVTH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.