NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209501_10431794

Scaffold Ga0209501_10431794


Overview

Basic Information
Taxon OID3300027844 Open in IMG/M
Scaffold IDGa0209501_10431794 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)771
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)75.2588Long. (o)-156.0227Alt. (m)Depth (m)208
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001319Metagenome / Metatranscriptome723Y
F013703Metagenome / Metatranscriptome269Y

Sequences

Protein IDFamilyRBSSequence
Ga0209501_104317941F013703N/ALDNTKIVLQTFVSYTLFRYFEGLKSETKYLLLESPILIYPGINVDIPVTETFKMNLGFNVGINTLVNDLGRRNITYSLIFGTNF
Ga0209501_104317942F001319AGGAGMKKIIGLLLLGVLYGQMPEPTLIGQDNLEVPTLSISNFVNQAEIKGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFEMKARVVYLGRPRKSATILGLFKRESTTTEVRVIVELINKKTGKVSSGNGTGFTKRDISSTGFQINEELPFDRSELGGALKEAINNAVQE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.