Scaffold Ga0209501_10339536

Overview

Basic Information

• Taxon OID: 3300027844
• Scaffold ID: Ga0209501_10339536
• Source Dataset Name: Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 909
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location

• Location Name: Arctic Ocean: Canada Basin
• Coordinates
  • Lat. (^o): 75.2588
  • Long. (^o): -156.0227
  • Depth (m): 208

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013420	Metagenome	271	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209501_103395363	F013420	N/A	MDTPTDIRQVRIPTVALGLILSVAAIVGTVTWSSARLVARIDHLEATVSSIEQTMDMNAYARSVDLEDLQVTVNYLSVALDDLGDMIDDDWSVEN