| Basic Information | |
|---|---|
| Taxon OID | 3300027841 Open in IMG/M |
| Scaffold ID | Ga0209262_10230084 Open in IMG/M |
| Source Dataset Name | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 899 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater → Freshwater Pond Sediment Microbial Communities From The University Of Edinburgh, Under Environmental Carbon Perturbations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Crawford Collection of the Royal Observatory Edinburgh | |||||||
| Coordinates | Lat. (o) | 55.9225 | Long. (o) | -3.1724 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054139 | Metagenome | 140 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209262_102300842 | F054139 | GAGG | VTVEMNWEPRGVRSRFTGAVTAADLLHHVIEVCRHSDFSGLRFSILDFRDAKDEVNDKDLFEVRAHLIGAQVTNPYILVAALTTDLGAIEHLTRFIRLGALNRQIQIFSTPELAMDWIAEQSMFLH |
| ⦗Top⦘ |