Scaffold Ga0209403_10095906

Overview

Basic Information

• Taxon OID: 3300027839
• Scaffold ID: Ga0209403_10095906
• Source Dataset Name: Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1981
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location

• Location Name: Arctic Ocean: Canada Basin
• Coordinates
  • Lat. (^o): 79.2466
  • Long. (^o): -150.0613
  • Depth (m): 190

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002125	Metagenome / Metatranscriptome	591	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209403_100959064	F002125	N/A	RTAVIALVGEPSLTSVDLFVSKDTANLTFLRKRQQFIIEVQKVNK