Scaffold Ga0209230_10095829

Overview

Basic Information

• Taxon OID: 3300027836
• Scaffold ID: Ga0209230_10095829
• Source Dataset Name: Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1643
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location

• Location Name: Canada: Lake Ontario
• Coordinates
  • Lat. (^o): 43.933506
  • Long. (^o): -78.003845

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035632	Metagenome / Metatranscriptome	171	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209230_100958291	F035632	N/A	MEKFLGITVTNQQVQIVSATGIVLIEQNSTTTVEIHYKSSTGTDVVTITHAAAGAGDETMRDAIQDAVVRALTTSWTNVLYTVENLPYAVSNIAVA