Scaffold Ga0209344_10001537

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209344_10001537

Scaffold Ga0209344_10001537

Overview

Basic Information
Taxon OID	3300027834 Open in IMG/M
Scaffold ID	Ga0209344_10001537 Open in IMG/M
Source Dataset Name	Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Santa Barbara Oil Seep Sample 6 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	29442
Total Scaffold Genes	24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	21 (87.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Channel Oil Seeps

Source Dataset Sampling Location
Location Name	Coal Oil Point, Santa Barbara, CA
Coordinates	Lat. (^o)	34.39225	Long. (^o)	-119.845662	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048322	Metagenome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209344_1000153721	F048322	GAG	MRYTKSLMLWCLQKMQEYWWYVEAFCKRPERKESVQIAGENRSI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.