NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209092_10018094

Scaffold Ga0209092_10018094


Overview

Basic Information
Taxon OID3300027833 Open in IMG/M
Scaffold IDGa0209092_10018094 Open in IMG/M
Source Dataset NameMarine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4835
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (61.54%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameFram Strait
CoordinatesLat. (o)69.2303Long. (o)7.7302Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031028Metagenome / Metatranscriptome183Y
F087754Metagenome / Metatranscriptome110N

Sequences

Protein IDFamilyRBSSequence
Ga0209092_100180942F087754GGAMSYKIEAGSKEEWAERALSSEKKLTSLKDNVRELFSLLDATEETDEGRVHRPVQIVCVRTDMLIKLENVLATLKSTMEDKG
Ga0209092_100180943F031028GGAGGMKFTHQHSDGTKIEIEMAEHASMDNVLEEFQNFLRACGYTIEYNKVLTIEDMDE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.