| Basic Information | |
|---|---|
| Taxon OID | 3300027832 Open in IMG/M |
| Scaffold ID | Ga0209491_10079607 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3171 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater → Freshwater Microbial Communities From Lake Liftoff Mats And Glacier Meltwater In Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Bonney | |||||||
| Coordinates | Lat. (o) | -77.714 | Long. (o) | 162.445 | Alt. (m) | Depth (m) | 83 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019282 | Metagenome / Metatranscriptome | 230 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209491_100796074 | F019282 | GAG | MFALLAMTMLDDIDTINTWAEPHNANGVTPNTVIDSNDEPPQNNQQRMAARGY |
| ⦗Top⦘ |