| Basic Information | |
|---|---|
| Taxon OID | 3300027831 Open in IMG/M |
| Scaffold ID | Ga0209797_10344701 Open in IMG/M |
| Source Dataset Name | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 613 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment → Wetland Sediment Microbial Communities From St. Louis River Estuary, Michigan Under Dissolved Organic Matter Induced Mercury Methylation |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan, St. Louis River estuary | |||||||
| Coordinates | Lat. (o) | 46.6972164 | Long. (o) | -92.3279105 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F055832 | Metagenome | 138 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209797_103447011 | F055832 | N/A | MGRLVRLVVVAAVAWAAWHAGMAAWQQFQFTDEVGKIAQFGPDRDVESVRDAVMEAAARLDLPVAEKDIRVRRQERPSELYIDVSYTVRVEILPRYFYPWTFTVNAHGWFVPGGRAPLK |
| ⦗Top⦘ |