| Basic Information | |
|---|---|
| Taxon OID | 3300027830 Open in IMG/M |
| Scaffold ID | Ga0209359_10006098 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3664 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (55.56%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Affecting The Dissolved Organic Carbon Pool |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | -38.0018 | Long. (o) | -44.9985 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F048369 | Metagenome / Metatranscriptome | 148 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209359_100060983 | F048369 | GAG | MKEDRNDFIDMLADNTPHEGQFDKLKEAEVQDAEEDLCGGKTFKKLKDEVKRGEK |
| ⦗Top⦘ |