Scaffold Ga0209692_10270567

Overview

Basic Information

• Taxon OID: 3300027828
• Scaffold ID: Ga0209692_10270567
• Source Dataset Name: Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 757
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Atlantic Coast Under Amendment With Organic Carbon And Nitrate

Source Dataset Sampling Location

• Location Name: Atlantic Coast
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095491	Metagenome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209692_102705671	F095491	N/A	GSAGAFAEKLIEELEKLIEPEIKSFLANSTERVLERAAEFTIAKIDEPASIEFRATFVDFMLSKSPAFFLEAASDELIGDMGAVVELSARHLAEAPDMHAGIHRWIDRVMDYSSDKTLGEVLQLEESAARPPIDALADATWPAFIAVLASPQAQAWMDTLLDELIEEYERIAD