Scaffold Ga0209035_10602778

Overview

Basic Information

• Taxon OID: 3300027827
• Scaffold ID: Ga0209035_10602778
• Source Dataset Name: Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 524
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Affecting The Dissolved Organic Carbon Pool

Source Dataset Sampling Location

• Location Name: South Atlantic Ocean
• Coordinates
  • Lat. (^o): -37.9831
  • Long. (^o): -44.9892
  • Depth (m): 754

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105906	Metagenome / Metatranscriptome	100	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209035_106027782	F105906	AGGA	MITIKTLNAVQRELNENKEFVQSNEYCVVEPGFSGFYQDEIIKHESLLIYLTRENLNSVNLLPHCDVI