NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209035_10096699

Scaffold Ga0209035_10096699


Overview

Basic Information
Taxon OID3300027827 Open in IMG/M
Scaffold IDGa0209035_10096699 Open in IMG/M
Source Dataset NameMarine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1458
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Affecting The Dissolved Organic Carbon Pool

Source Dataset Sampling Location
Location NameSouth Atlantic Ocean
CoordinatesLat. (o)-37.9831Long. (o)-44.9892Alt. (m)Depth (m)754
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006919Metagenome362Y
F032311Metagenome / Metatranscriptome180Y

Sequences

Protein IDFamilyRBSSequence
Ga0209035_100966991F032311N/ANKPVFKFKSPNSDMMIHVFLRKMAPPAKKHTMAFNYQLEDK
Ga0209035_100966993F006919AGGMKSFIQHLKEFTIKSTSDLVFEVGSQGLASSALKIPISGPMFKRIWPDTIRSTVFHVTDAENIYDLKKLEGKKKSISAFFSMTARQMEHGIASGGGVVAELDADVLVSARDDIMSQVDKAGRRWVEMSWFENQASRGLSKSGFQAVERELNVLIRNLVLKHLEPILGNKARTEPEFYLWADMKRHLKDSKKLSLVIKDYFDGVESIIKKNKEVMGDIFYSYARSKRQTDNTWDEQIVNNIEITKLHYLPKEEEIEDEEQQENIDAFVAKYKIPSKRWEYSSELEIYTRQVIQAEIRTMAR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.