NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209039_10000242

Scaffold Ga0209039_10000242


Overview

Basic Information
Taxon OID3300027825 Open in IMG/M
Scaffold IDGa0209039_10000242 Open in IMG/M
Source Dataset NameBog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)51535
Total Scaffold Genes45 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)26 (57.78%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada

Source Dataset Sampling Location
Location NameCalvert Island, British Columbia, Canada
CoordinatesLat. (o)51.62Long. (o)-128.09Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000477Metagenome / Metatranscriptome1097Y
F005307Metagenome / Metatranscriptome405Y
F011616Metagenome / Metatranscriptome289Y
F018212Metagenome / Metatranscriptome236Y

Sequences

Protein IDFamilyRBSSequence
Ga0209039_1000024212F005307AGGMDRGIAVRAALKAGVLGVFIGMIPFLGIVLTGALAVFFYRRENGFALPTALGSRLGGAAGVVAFAINALLITIRIFVFHAQQEYTDTILKIAQRFGANAADPDFQASIHNLFTPSGLALTFFCGMIVTVVLASIGGALASLLLRPRNTRE
Ga0209039_1000024222F018212N/AMWGAYRWSARFLLLVMLAPAFGPLAMAHCAQPGAMHCMRQSVSAHPAMPCHHAMAQSQPPHPESPQVEASATSFQANHDDNCCPNHCCCGATTSAWAQPASNLLPFVCLLIEPARSSPSALLQSSDISGHDSARAPPRS
Ga0209039_1000024230F000477AGGGGGMPATTTKKFTPEIDAQLYDEFVAVAERNGQTKRHVLEEALRFYLHNVVPSQHLVRPDVMDAFEQSVARNRDLLQRLAK
Ga0209039_100002428F011616AGGVNAPVPPKPIADDKHQDKHQHRHSIYAAEASGLLLMAVLLLILTIIRYWRYIPWSAR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.