| Basic Information | |
|---|---|
| Taxon OID | 3300027824 Open in IMG/M |
| Scaffold ID | Ga0209040_10051409 Open in IMG/M |
| Source Dataset Name | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2482 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (100.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Calvert Island, British Columbia, Canada | |||||||
| Coordinates | Lat. (o) | 51.62 | Long. (o) | -128.09 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001709 | Metagenome / Metatranscriptome | 648 | Y |
| F012890 | Metagenome / Metatranscriptome | 276 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209040_100514093 | F001709 | GGAG | MPQEVSVSYQAIKSKVYRLIDTLVVGEKSELEIQESIRRWWELIHPTDRPIAQKYLLLVLGRSCQALDAIEEGLTDATNHDAFRPESTRATFRLVERVVKQSSKHAAYSSSI |
| Ga0209040_100514094 | F012890 | GGAGG | MKKLAGILLFPLLICTLGMAQDSPSANSSQNAASGDKMFFPRDMFWGWAQFDLAPPHNEIDPNICAGNAGQYGGVNAPCSMFARYMLSGMLEV |
| ⦗Top⦘ |