| Basic Information | |
|---|---|
| Taxon OID | 3300027822 Open in IMG/M |
| Scaffold ID | Ga0209633_10051113 Open in IMG/M |
| Source Dataset Name | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 1 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2769 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Channel Oil Seeps |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Coal Oil Point, Santa Barbara, CA | |||||||
| Coordinates | Lat. (o) | 34.39225 | Long. (o) | -119.845662 | Alt. (m) | Depth (m) | 47 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005815 | Metagenome / Metatranscriptome | 389 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209633_100511133 | F005815 | AGGA | MTMKVTRLTTYWTLDEAATAIDFLDRLRDALWETYGEQITRMHREDYDNHTQDINQCELGFDDDIPF |
| ⦗Top⦘ |