Scaffold Ga0209514_10045321

Overview

Basic Information

• Taxon OID: 3300027819
• Scaffold ID: Ga0209514_10045321
• Source Dataset Name: Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3160
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (16.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater → Groundwater Microbial Communities From Coal-Tar-Waste-Contaminated Well In S. Glens Falls, New York, Usa

Source Dataset Sampling Location

• Location Name: S. Glens Falls, New York, USA
• Coordinates
  • Lat. (^o): 43.099444
  • Long. (^o): -73.604444
  • Depth (m): 5.8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040249	Metagenome	162	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209514_100453216	F040249	N/A	MQLLIRDPAYTERLASFLRSLGQSPIISGPDHVELDPPTTPGDRAELEIYLRV