| Basic Information | |
|---|---|
| Taxon OID | 3300027815 Open in IMG/M |
| Scaffold ID | Ga0209726_10503391 Open in IMG/M |
| Source Dataset Name | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 543 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater → Groundwater Microbial Communities From Coal-Tar-Waste-Contaminated Well In S. Glens Falls, New York, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | S. Glens Falls, New York, USA | |||||||
| Coordinates | Lat. (o) | 43.292222 | Long. (o) | -73.604444 | Alt. (m) | Depth (m) | 5.4 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F027686 | Metagenome / Metatranscriptome | 194 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209726_105033911 | F027686 | N/A | RRLRRAMDEKEIGRVWAEYYPKSGDNRDALQMCGLICRLIREKSRFVIAFRRSGRLQRVLDACGILKADFDEVEKRLFKA |
| ⦗Top⦘ |