Basic Information | |
---|---|
Taxon OID | 3300027815 Open in IMG/M |
Scaffold ID | Ga0209726_10016506 Open in IMG/M |
Source Dataset Name | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 6646 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (71.43%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater → Groundwater Microbial Communities From Coal-Tar-Waste-Contaminated Well In S. Glens Falls, New York, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | S. Glens Falls, New York, USA | |||||||
Coordinates | Lat. (o) | 43.292222 | Long. (o) | -73.604444 | Alt. (m) | Depth (m) | 5.4 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F101737 | Metagenome | 102 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209726_100165065 | F101737 | AGGA | MATKTGTWLMAIGSFIAFVGLCFLPAAFGPDSDRTMLSAGAVVVSTGLLLIAGGLYVKARTLGTAAAPAGASASGKRTRKSICDRCGLNEPVIQCRVHQLHLCADCLSNHYDFRSCAYVPSTRRGAPAKSNAAAYSQATSS |
⦗Top⦘ |