Scaffold Ga0209726_10016506

Overview

Basic Information

• Taxon OID: 3300027815
• Scaffold ID: Ga0209726_10016506
• Source Dataset Name: Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6646
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater → Groundwater Microbial Communities From Coal-Tar-Waste-Contaminated Well In S. Glens Falls, New York, Usa

Source Dataset Sampling Location

• Location Name: S. Glens Falls, New York, USA
• Coordinates
  • Lat. (^o): 43.292222
  • Long. (^o): -73.604444
  • Depth (m): 5.4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101737	Metagenome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209726_100165065	F101737	AGGA	MATKTGTWLMAIGSFIAFVGLCFLPAAFGPDSDRTMLSAGAVVVSTGLLLIAGGLYVKARTLGTAAAPAGASASGKRTRKSICDRCGLNEPVIQCRVHQLHLCADCLSNHYDFRSCAYVPSTRRGAPAKSNAAAYSQATSS