Scaffold Ga0209302_10160522

Overview

Basic Information

• Taxon OID: 3300027810
• Scaffold ID: Ga0209302_10160522
• Source Dataset Name: Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1095
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Arctic Ocean
• Coordinates
  • Lat. (^o): 78.8669
  • Long. (^o): -3.2286
  • Depth (m): 15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031473	Metagenome / Metatranscriptome	182	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209302_101605222	F031473	N/A	MEEIREFIEESFTPRVEEDMNGIKVVFTSTVGDGIIWFEPAKRGWSKKPLSTNQYIIVDAELSHVLTFLNRYYQLDETNYHDIRRMFIDIGMDTVDRHTKGADNI