Scaffold Ga0209208_10068375

Overview

Basic Information

• Taxon OID: 3300027807
• Scaffold ID: Ga0209208_10068375
• Source Dataset Name: Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2758
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Communities From Peat Moss Sphagnum Species From Minnesota, Usa

Source Dataset Sampling Location

• Location Name: USA: Minnesota
• Coordinates
  • Lat. (^o): 47.5028
  • Long. (^o): -93.4828

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048722	Metagenome	147	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209208_100683754	F048722	N/A	MNLSDYSTKVKYLADAFASIGAFVDDEDLMVVTLNGLGKDYS