NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209208_10026150

Scaffold Ga0209208_10026150


Overview

Basic Information
Taxon OID3300027807 Open in IMG/M
Scaffold IDGa0209208_10026150 Open in IMG/M
Source Dataset NameHost-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6252
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (70.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Communities From Peat Moss Sphagnum Species From Minnesota, Usa

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024943Metagenome / Metatranscriptome203Y
F082045Metagenome / Metatranscriptome113Y
F098502Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0209208_100261504F082045N/AMQGDLFILESWLDLTTWVEEIQLVAMEITKGKPSRVWCMIECVKQHHEDHKHESFCLTPRLFLDITCNPRHELKLDLWESEKIHKGKLQARREKQMARVKPYEKM
Ga0209208_100261505F098502N/AMSMLGEASDSPGTQFPQDRQQTPSLTLVVARPRSPIRRPLEEPRIVGELGVVVSQLRRRREESKPQLDPKFVRQRQRTITQEQHLFIWLRKKDATLDYAKTNNLHVMWSGGIIDTRDGHDLVNVVFQSRHLNRMIAGLEMFGPFINVHQKDRENFIMSANRAIGNFLIHKERL
Ga0209208_100261506F024943AGGAVWCLFFYRDKIRINMVIPVFRGSKGEDPEVFLREYKWACIGTGLRTVVEWLNFIPEFLEVTASHWFE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.