| Basic Information | |
|---|---|
| Taxon OID | 3300027806 Open in IMG/M |
| Scaffold ID | Ga0209985_10405190 Open in IMG/M |
| Source Dataset Name | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 591 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom. |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Ohio, Lake Erie | |||||||
| Coordinates | Lat. (o) | 41.69957 | Long. (o) | -83.2941 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F058733 | Metagenome / Metatranscriptome | 134 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209985_104051901 | F058733 | N/A | AARSARQINFESRLGAHDVGNDCLMSIDGTDFRVEQQGPAVRGNPFGSHKYAGKSALRYELGIDILAGNLVWVGGPYPAGAWPDIKIFMNELAHLLEPGERVEADNGYVGHPEKIKCPNNDCNPVENLEMQARLRSRHETFNGRLKFWGILGQVFRHDIRLHGSVFWACAVISQLAVVNDEPLFEVEYGDK |
| ⦗Top⦘ |