| Basic Information | |
|---|---|
| Taxon OID | 3300027805 Open in IMG/M |
| Scaffold ID | Ga0209229_10020043 Open in IMG/M |
| Source Dataset Name | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2879 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (71.43%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sandusky Bay, Ohio, USA | |||||||
| Coordinates | Lat. (o) | 41.474889 | Long. (o) | -82.854137 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F057360 | Metagenome / Metatranscriptome | 136 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209229_100200434 | F057360 | AGG | VSYHFGFKYWNEPTPAKIRRVASALAAAGIAGCGFAYLRDNITLAITLLSLAVGGSFIAKLFTDKP |
| ⦗Top⦘ |