| Basic Information | |
|---|---|
| Taxon OID | 3300027805 Open in IMG/M |
| Scaffold ID | Ga0209229_10011999 Open in IMG/M |
| Source Dataset Name | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3680 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sandusky Bay, Ohio, USA | |||||||
| Coordinates | Lat. (o) | 41.474889 | Long. (o) | -82.854137 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003927 | Metagenome / Metatranscriptome | 461 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209229_100119994 | F003927 | GAG | MATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVDATFNGTFTVRALPQYLFLGIDTQGDLLYDYQVPIADQVLYAKTADDVSRVAASGTVANDPVCTWVTAAQVMAYLGIT |
| ⦗Top⦘ |