Scaffold Ga0209910_10030577

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209910_10030577

Scaffold Ga0209910_10030577

Overview

Basic Information
Taxon OID	3300027803 Open in IMG/M
Scaffold ID	Ga0209910_10030577 Open in IMG/M
Source Dataset Name	Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712S3S
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	577
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost → Thawing Permafrost Microbial Communities From The Arctic, Studying Carbon Transformations

Source Dataset Sampling Location
Location Name	Sweden: Kiruna
Coordinates	Lat. (^o)	68.3533	Long. (^o)	19.0475	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011332	Metagenome / Metatranscriptome	292	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209910_100305771	F011332	N/A	QDKEKMLRELHREVLDAIREGKLDSILDKRETPETLAAVKELDLTWVNATSVHSGGALIMQIRVTDGGATVSGARLTLRFTRPKAEPFYAQVLTDATGVAEMHVRVDEKDLPDSSVLVQVGFEGRTATRKFLLREAS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.