NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209091_10064515

Scaffold Ga0209091_10064515


Overview

Basic Information
Taxon OID3300027801 Open in IMG/M
Scaffold IDGa0209091_10064515 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2061
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)77.0991Long. (o)-150.2252Alt. (m)Depth (m)58
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001930Metagenome615Y

Sequences

Protein IDFamilyRBSSequence
Ga0209091_100645153F001930N/AMKSFQQHLKEEVAWQQSTSKMIFDFGQTGNMKIPLSSKMMTWIFNVQLPRVTVFHVTNGIGLGNLKKLQNKKKSISAFFNMHASFIDSGIKTAGGLVAELDANILMSSKNDILSMPDKAGRRWVELHYIDTNEKMEPEFEKMLIDLAIKHDPKNKEYLKTVPEIGVGVWYKLQTDFQDDGKKMSLIIADYIDGVATILKKYKNDIQGKVHGYIVRRGTIAVKHPSGRMVGGDSKLSEWDAWDEQVVNEIKIEKVHTFNTATRPFEWIDDSVIPRLGRIPHKHWKSAEELSTYITQVADAEVRTFGGWARKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.