NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209107_10013915

Scaffold Ga0209107_10013915


Overview

Basic Information
Taxon OID3300027797 Open in IMG/M
Scaffold IDGa0209107_10013915 Open in IMG/M
Source Dataset NameFreshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4562
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (58.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Roseibacillus → Roseibacillus ishigakijimensis(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameLake Erie, Canada
CoordinatesLat. (o)41.77Long. (o)-81.73Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054031Metagenome / Metatranscriptome140Y
F071229Metagenome / Metatranscriptome122Y
F093858Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0209107_1001391510F093858GGAGGMIDLHDPASVCRSLGYFLDFLVIFVPPVALAFTAWRIAR
Ga0209107_100139158F071229GGAGMSDTTAIVSACLIMLSLYTTFQLGIECERERIRRERRRRFEEDNHDSANHDDFD
Ga0209107_100139159F054031GGAGGMSDPNWSEIEANRDRAETLPECDWTTETPETEAAVKASGSTFGIPLRETSRRLERQRNGLYQLLNRRAGQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.