NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209972_10156523

Scaffold Ga0209972_10156523


Overview

Basic Information
Taxon OID3300027793 Open in IMG/M
Scaffold IDGa0209972_10156523 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1088
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom.

Source Dataset Sampling Location
Location NameUSA: Ohio, Lake Erie
CoordinatesLat. (o)41.69957Long. (o)-83.2941Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000706Metagenome / Metatranscriptome926Y
F002934Metagenome / Metatranscriptome519Y
F004050Metagenome / Metatranscriptome455Y

Sequences

Protein IDFamilyRBSSequence
Ga0209972_101565232F002934AGGAGGMNMKHPALIAVGAFLAVWGTTSNFDLNYRSILGAIVAGVFGYASPKK
Ga0209972_101565233F000706GAGMSASDMMTFYFASLAVIGGLAGFVITHLLNEIKALHARVDEIYNILLER
Ga0209972_101565234F004050GAGMAKKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDICLAIISDRDAYPDWILPSIPNRVDRIPYEDDEDED

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.