NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209074_10252662

Scaffold Ga0209074_10252662


Overview

Basic Information
Taxon OID3300027787 Open in IMG/M
Scaffold IDGa0209074_10252662 Open in IMG/M
Source Dataset NameAgricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)686
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.8834Long. (o)-83.4195Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001698Metagenome / Metatranscriptome650Y
F002850Metagenome / Metatranscriptome526Y

Sequences

Protein IDFamilyRBSSequence
Ga0209074_102526621F001698N/AMRFNHDLAENFSTIQSHWRELGEVWRDDMYRLFGEALEEVLPGITAYLEATEGHEAHLAALIERLGGYLETGAGAGLGVGRAEVRRAQGTGSANGTGRRDRNPR
Ga0209074_102526622F002850GGAVTGIHADIDALKGLHGALARYRHAQRDVTARGEDQVRATRASLEEKASQLRAQLELCQGEYAGCRERAAQAGPEDLPVDCSGYARAVAQATERIEQIQRWRQRIDAEAGEFSGVAGRFAAMLADDLPRME
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.