NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207421_10160228

Scaffold Ga0207421_10160228


Overview

Basic Information
Taxon OID3300027784 Open in IMG/M
Scaffold IDGa0207421_10160228 Open in IMG/M
Source Dataset NameAlkaline sediment microbial communities from Lake Tanatar, Kulunda Steppe, Russia - 8KL_010_SED (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1081
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils

Source Dataset Sampling Location
Location NameRussia: Kulunda Steppe, Lake Tanatar
CoordinatesLat. (o)51.39Long. (o)79.48Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F066493Metagenome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0207421_101602283F066493GGAGGMSDAREFDSGVVDVADELVQRHGTSGAIDRLQRRRQTSNDELQARCTEAIAWIRRE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.