| Basic Information | |
|---|---|
| Taxon OID | 3300027784 Open in IMG/M |
| Scaffold ID | Ga0207421_10113287 Open in IMG/M |
| Source Dataset Name | Alkaline sediment microbial communities from Lake Tanatar, Kulunda Steppe, Russia - 8KL_010_SED (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1422 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Russia: Kulunda Steppe, Lake Tanatar | |||||||
| Coordinates | Lat. (o) | 51.39 | Long. (o) | 79.48 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F060332 | Metagenome / Metatranscriptome | 133 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0207421_101132872 | F060332 | GAG | VSAQIEPWSRTDVFHRVNEILPEQNKVKLTNGREYSYKALVVASGFDHKSANIEGLPEFEKDRGENQTFVHAIDHKERVDRNYYHGWHHPNGDMINYSPQMPYKGEGTDFYSLYYEHFLRQDKLQGRSAKNAKIQYWTPNKEIYKFPYANDVALDECNKRGIEVFFGWEMMSVKYNELG |
| ⦗Top⦘ |