NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209500_10011503

Scaffold Ga0209500_10011503


Overview

Basic Information
Taxon OID3300027782 Open in IMG/M
Scaffold IDGa0209500_10011503 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5438
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (70.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001483Metagenome / Metatranscriptome686Y
F030669Metagenome / Metatranscriptome184Y
F044496Metagenome / Metatranscriptome154Y
F047055Metagenome / Metatranscriptome150N

Sequences

Protein IDFamilyRBSSequence
Ga0209500_100115032F030669AGGMTYYVYGAEGSKTTDKVETLLTVCRRQYKLFILGQDYSIEQLRILVPETNFVPHIYHDAKYIGGIKELYDYLYSEVKMEKQFQNETRELDN
Ga0209500_100115033F047055GAGMKKSCTLHSIIASLFLCNTAYGKVTLVEDSSTKDGYYMAKVINVKPIIEKVPYMVTKNYCQKQYGTIHYSGPSTNTLILGVTPPFSTPVCKLVNEQTYHSVIKGYQVTYDFKGTLKTAILNNEPSGYVQVYDVP
Ga0209500_100115034F044496AGGAMKKILAVAVTALIATSAFANDIVNYEIVRVVKVDPIGNMKAYSMPRMSCTNIESGVSQVPVDGAPVGRQITQQQKCTSYSDREFRYNVTAFNVTFEYQGQIRTVKMDYDPGNAIRIKTVTKVYAVE
Ga0209500_100115039F001483AGGAMDKLKELLLELLKFIGESPFRLFTVILLCFLGFGGWIIYSEKDAFMASYRAQQAMPKMNGKYEEAVNFILKNTDAELVAVFNVNTLLNTRKLAYLTTRGAGRNTAYDGVNVGLLTKNHSNNEDVIGLMSGKIPCGPYLTPQSYIGFTYKDAGVKYMCRISVPAEPGLFIGQISVGWKEQPTEVEVAQTVLIVASSLLFDKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.