Scaffold Ga0209502_10080816

Overview

Basic Information

• Taxon OID: 3300027780
• Scaffold ID: Ga0209502_10080816
• Source Dataset Name: Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1697
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location

• Location Name: Arctic Ocean: Canada Basin
• Coordinates
  • Lat. (^o): 79.2466
  • Long. (^o): -150.0613
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052198	Metagenome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209502_100808162	F052198	GGAG	MNKAELEDKVNELELTLNSLELNAKTVKDDLKIVEGQLANINKVKITRDIVNDIRDVIEQSIRNSSLSNTDSYEVDFEIDYNNSLALGSIEFNDADQLSEEISDGIESLFSVVEE