NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209502_10052346

Scaffold Ga0209502_10052346


Overview

Basic Information
Taxon OID3300027780 Open in IMG/M
Scaffold IDGa0209502_10052346 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2240
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)79.2466Long. (o)-150.0613Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F066233Metagenome / Metatranscriptome127N
F080617Metagenome / Metatranscriptome115N
F099229Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0209502_100523462F080617N/AMSDNKLKWSLEKLFNTVGRNLAMNYYGFDSEYEVVSIIDEKTGEEVTDSDLGNTENYTATVKSKEPLPEIFDVKIEPLFRYGKYAQPMDLQFNLENLTKYISPNQIAVQLVGPEWKSGENTYRTLQSFEDKWGRSLDRDANDFQVSPNSWIELSNGSVVDKLTGDSFPLMSNGLIDKTEVWNIARVDDDEWWDSLSDEDKRNLTNNFS
Ga0209502_100523463F099229N/AMLDNIKNIEEIGKVLLNTPTLRTIYKDKFEIKTVDFEFVEKSSSSQFTSKYEHYIFRVTLYTDISINFDERIKSGEIDSYEYIEPELWDYGIDPFYLADIIIPDQILNIIVPRDGTKIAIELTILGDEGQIIWNDDMFGRPASSQFH
Ga0209502_100523464F066233N/AMEIEKNIEDELRADAQEKGEVATKILDALVFSKFGGIEYSMMVRRQRQNSYSSNNIANPIYFEFDVDIDVDKTFEPSPTYDKKYEDYIYEIGEHIERALRYVNLHDYMTEPMFTYVNDNLVENEVDRLENKLVLYLQSQYEGLSYDSIREADIGYYFYKGETDNPYMRVEYIGHPPIIDGDRQSTDTIEEREYFSCEDLYDIMSDLYDRSPLSLSYDGENYTCQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.