NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209709_10001297

Scaffold Ga0209709_10001297


Overview

Basic Information
Taxon OID3300027779 Open in IMG/M
Scaffold IDGa0209709_10001297 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)23189
Total Scaffold Genes32 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)29 (90.62%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)75.235Long. (o)-150.0691Alt. (m)Depth (m)79
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008210Metagenome / Metatranscriptome337Y
F063590Metagenome / Metatranscriptome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0209709_100012972F008210AGGAMAVTVNNLKLTQVQGVVSVRGTAATGTIALATTLKKSSESQNSPAVNIKGLKWTLSSGASAKVQRNSVVLYELTESGNIDMYGFSDNSEATSDIEVVIAGGAGGTVIVDCAKVSGYGSQQHQDAPLDTNDSGSVYNGGSLG
Ga0209709_1000129728F063590AGGAGMIEILQEVTDWDGVNITNGIYHVNKKTGHLVQYNDKVFKSPLKQFSKSRRKFKKIGERD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.